Recombinant Clostridium Acetobutylicum CTFB Protein (1-221 aa), His-Myc-tagged

• Cat.No.: CTFB-2649C
• Product Overview: Recombinant Clostridium Acetobutylicum (strain ATCC 824/DSM 792/JCM 1419/LMG 5710/VKM B-1787) CTFB Protein (1-221 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Species: Clostridium Acetobutylicum
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 1-221 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 30.6 kDa
• AA Sequence: MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ctfb butyrate-acetoacetate COA-transferase subunit B [ Clostridium acetobutylicum ATCC 824 ]
• Official Symbol: CTFB
• Synonyms: ctfB
• Gene ID: 1116169
• Protein Refseq: NP_149327
• UniProt ID: P23673