Recombinant Ciona Intestinalis RPS13 Protein (2-151 aa), His-Myc-tagged
Cat.No. : | RPS13-2577C |
Product Overview : | Recombinant Ciona Intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13 Protein (2-151 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ciona Intestinalis |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-151 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.9 kDa |
AA Sequence : | GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | rps13 rs13 protein [ Ciona intestinalis (vase tunicate) ] |
Official Symbol | RPS13 |
Synonyms | RPS13; rs13; |
Gene ID | 445688 |
mRNA Refseq | NM_001032506 |
Protein Refseq | NP_001027678 |
UniProt ID | Q8I7D6 |
◆ Recombinant Proteins | ||
RPS13-2577C | Recombinant Ciona Intestinalis RPS13 Protein (2-151 aa), His-Myc-tagged | +Inquiry |
RPS13-5182H | Recombinant Human RPS13 protein, GST-tagged | +Inquiry |
RPS13-14468M | Recombinant Mouse RPS13 Protein | +Inquiry |
RPS13-5149R | Recombinant Rat RPS13 Protein | +Inquiry |
RPS13-3829R | Recombinant Rhesus Macaque RPS13 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS13-558HCL | Recombinant Human RPS13 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS13 Products
Required fields are marked with *
My Review for All RPS13 Products
Required fields are marked with *
0
Inquiry Basket