Recombinant Ciona Intestinalis RPS13 Protein (2-151 aa), His-Myc-tagged

• Cat.No.: RPS13-2577C
• Product Overview: Recombinant Ciona Intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13 Protein (2-151 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein.

Specification

• Source: E. coli
• Species: Ciona Intestinalis
• Tag: His&Myc
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 23.9 kDa
• Protein length: 2-151 aa
• AA Sequence: GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: rps13 rs13 protein [ Ciona intestinalis (vase tunicate) ]
• Official Symbol: RPS13
• Synonyms: RPS13; rs13
• Gene ID: 445688
• mRNA Refseq: NM_001032506
• Protein Refseq: NP_001027678
• UniProt ID: Q8I7D6