Recombinant Chicken Tnfsf13b Protein

• Cat.No.: Tnfsf13b-20C
• Product Overview: Recombinant chicken BAFF protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Description: BAFF (B-cell Activation Factor), also know as Tumor Necrosis Factor Superfamily member 13B (TNFSF13B) is a member of the tumor necrosis factor ligand (TNF) ligand family. Nineteen cytokines have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha (TNFSF2), Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL(TNFSF13), BAFF (TNFSF13B), LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18). BAFF is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells.
• Source: Yeast
• Species: Chicken
• Molecular Mass: 17.0 kDa
• AA Sequence: SIVNAEETVLQACLQLIADSKSDIQQKDDSSIVPWLLSFKRGTALEEQGNKIVIKETGYFFIYGQVLYTDTTFAMGHLIQRKKAHVFGDDLSLVTLFRCIQNMPQSYPNNSCYTAGIAKLEEGDELQLTIPRRRAKISLDGDGTFFGAVRLL(152)
• Applications: The Chicken BAFF endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control.

Gene Information

• Gene Name: TNFSF13B tumor necrosis factor superfamily member 13b [ Gallus gallus (chicken) ]
• Official Symbol: Tnfsf13b
• Synonyms: TNFSF13B; tumor necrosis factor superfamily member 13b; tumor necrosis factor ligand superfamily member 13B; B-cell-activating factor BAFF; TNF superfamily member 13b; tumor necrosis factor (ligand) superfamily, member 13b
• Gene ID: 374229
• mRNA Refseq: NM_204327
• Protein Refseq: NP_989658
• UniProt ID: Q8JHJ4