Recombinant Chicken RHOT1 Protein (1-219 aa), His-SUMO-tagged

• Cat.No.: RHOT1-2027C
• Product Overview: Recombinant Chicken RHOT1 Protein (1-219 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Partial.

Specification

• Description: Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).
• Source: E. coli
• Species: Chicken
• Tag: His&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 41.0 kDa
• Protein length: 1-219 aa
• AA Sequence: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: RHOT1 ras homolog family member T1 [ Gallus gallus (chicken) ]
• Official Symbol: RHOT1
• Synonyms: RHOT1; MIRO-1 Alternative name(s): Ras homolog gene family member T1
• Gene ID: 417410
• mRNA Refseq: NM_001006208
• Protein Refseq: NP_001006208
• UniProt ID: Q5ZM73