Recombinant Chicken IL8L2 Protein

• Cat.No.: IL8L2-1259C
• Product Overview: Recombinant Chicken IL8L2 protein (17-102aa) was expressed in E. coli.

Specification

• Species: Chicken
• Source: E.coli
• Tag: Non
• Protein Length: 17-102 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 9.4 kDa
• AA Sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQL
  IVKALMAKAQLNSDAP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: IL8L2 interleukin 8-like 2 [ Gallus gallus (chicken) ]
• Official Symbol: IL8L2
• Synonyms: 9E3; C-X-C motif chemokine 8; CEF-4; CEF-4/9E3 cytokine; IL-8; RSV-induced protein; chemokine (C-X-C motif) ligand 8; embryo fibroblast protein 1; putatitve interleukin-8; transformation-induced protein
• Gene ID: 396495
• UniProt ID: P08317