Species :	Chicken
Source :	E.coli
Tag :	Non
ProteinLength :	17-102 a.a.
Form :	Tris-based buffer, 50% glycerol.
Molecular Mass :	9.4 kDa
AA Sequence :	ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQL IVKALMAKAQLNSDAP
Purity :	Greater than 90% as determined by SDS-PAGE.
Storage :	The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Name	IL8L2 interleukin 8-like 2 [ Gallus gallus (chicken) ]
Official Symbol	IL8L2
Synonyms	9E3; C-X-C motif chemokine 8; CEF-4; CEF-4/9E3 cytokine; IL-8; RSV-induced protein; chemokine (C-X-C motif) ligand 8; embryo fibroblast protein 1; putatitve interleukin-8; transformation-induced protein
Gene ID	396495
UniProt ID	P08317

◆ Recombinant Proteins
Flt3l-02M	Active Recombinant Mouse Flt3l Protein, His-tagged	+Inquiry
RFL25982CF	Recombinant Full Length Chlorocebus Aethiops C-C Chemokine Receptor Type 3(Ccr3) Protein, His-Tagged	+Inquiry
SP1-4233R	Recombinant Rhesus Macaque SP1 Protein, His (Fc)-Avi-tagged	+Inquiry
RTL8C-2361HF	Recombinant Full Length Human RTL8C Protein, GST-tagged	+Inquiry
SC4MOL-7917M	Recombinant Mouse SC4MOL Protein, His (Fc)-Avi-tagged	+Inquiry
See All Flt3l Recombinant Proteins

◆ Native Proteins
LDH-216S	Active Native Porcine Lactate Dehydrogenase	+Inquiry
Luciferase-10V	Native Vibrio fischeri Luciferase	+Inquiry
ORM1-26392TH	Native Human ORM1	+Inquiry
Total RNA-01E	Native E. coli Total RNA	+Inquiry
Fgg-5421R	Native Rat Fibrinogen Gamma Chain	+Inquiry
See All LDH Native Proteins

◆ Cell & Tissue Lysates
CTNS-7199HCL	Recombinant Human CTNS 293 Cell Lysate	+Inquiry
OSBPL9-3530HCL	Recombinant Human OSBPL9 293 Cell Lysate	+Inquiry
UBE2S-562HCL	Recombinant Human UBE2S 293 Cell Lysate	+Inquiry
CSRP2-7232HCL	Recombinant Human CSRP2 293 Cell Lysate	+Inquiry
PAK4-3456HCL	Recombinant Human PAK4 293 Cell Lysate	+Inquiry
See All CTNS Cell & Tissue Lysates