Recombinant Chicken ANOS1 Protein (22-281 aa), His-tagged

• Cat.No.: ANOS1-2086C
• Product Overview: Recombinant Chicken ANOS1 Protein (22-281 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Chicken
• Source: E.coli
• Tag: His
• ProteinLength: 22-281 aa
• Description: May be an adhesion-like molecule with anti-protease activity.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.2 kDa
• AA Sequence: SPAGPGAATARRQDEAFSTARCTSRCLSLQITRISAFFKHFQNNGSLAWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEADSECSGVKKCCSNGCGHTCQVPKNLYKGVPLKPRKELKFIELQSGDLEVKWSSKFNISIEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: ANOS1 anosmin 1 [ Gallus gallus (chicken) ]
• Official Symbol: ANOS1
• Synonyms: KAL; KAL1; anosmin-1
• Gene ID: 396395
• mRNA Refseq: NM_205424
• Protein Refseq: NP_990755
• UniProt ID: P33005