Recombinant Celery Apig 1 protein, His-SUMO-tagged
Cat.No. : | Apig 1-4038C |
Product Overview : | Recombinant Celery Apig 1 protein(P49372)(1-154aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Celery |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 1-154aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.3 kDa |
AA Sequence : | MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
LRRTM3-6109HF | Recombinant Full Length Human LRRTM3 Protein | +Inquiry |
INS-41P | Porcine Insulin | +Inquiry |
CHRM4-2855C | Recombinant Chicken CHRM4 | +Inquiry |
PXMP4-4855R | Recombinant Rat PXMP4 Protein | +Inquiry |
GHRL-2749H | Recombinant Human GHRL Protein (Ser25-Lys117), His tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
MMP1-45H | Native Human MMP-1 | +Inquiry |
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
FABP-176P | Native Porcine Fatty acid Binding Protein | +Inquiry |
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LACRT-4831HCL | Recombinant Human LACRT 293 Cell Lysate | +Inquiry |
EWSR1-6514HCL | Recombinant Human EWSR1 293 Cell Lysate | +Inquiry |
SLC9A1-1695HCL | Recombinant Human SLC9A1 293 Cell Lysate | +Inquiry |
SCNM1-2029HCL | Recombinant Human SCNM1 293 Cell Lysate | +Inquiry |
PSMG1-2736HCL | Recombinant Human PSMG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Apig 1 Products
Required fields are marked with *
My Review for All Apig 1 Products
Required fields are marked with *
0
Inquiry Basket