Recombinant Cat SAA1 Protein, His-B2M-tagged

• Cat.No.: SAA1-1363C
• Product Overview: Recombinant Cat SAA1 Protein (1-90aa) was expressed in E. coli with N-terminal His-B2M tag.

Specification

• Source: E. coli
• Species: Cat
• Tag: His&B2M
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 24.1 kDa
• AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDF
  FRHGNSGHGAEDSKADQEWG
• Purity: >97% as determined by SDS-PAGE and HPLC.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 1-90 a.a.

Gene Information

• Gene Name: LOC101099498 serum amyloid A protein-like [ Felis catus (domestic cat) ]
• Official Symbol: SAA1
• Synonyms: SAA; SAA1; serum amyloid A protein-like; Serum amyloid A protein
• Gene ID: 101099498
• UniProt ID: P19707