Recombinant Canis lupus DUT protein, His-tagged
Cat.No. : | DUT-12C |
Product Overview : | Recombinant Canis lupus DUT fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canis lupus |
Source : | E.coli |
Tag : | His |
Form : | 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0 |
Molecular Mass : | ~18.136 kDa |
AA Sequence : | MGHHHHHHTPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAGYDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN |
Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method |
Purity : | >95% by SDS-PAGE |
Gene Name | DUT deoxyuridine triphosphatase [ Canis lupus familiaris ] |
Official Symbol | DUT |
Synonyms | deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP pyrophosphatase |
Gene ID | 609526 |
Chromosome Location | chromosome: 30 |
Pathway | Metabolic pathways, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem |
◆ Recombinant Proteins | ||
FAM213AA-7786Z | Recombinant Zebrafish FAM213AA | +Inquiry |
CD63-4837H | Recombinant Human CD63 Full Length Transmembrane protein, His-tagged | +Inquiry |
HSPD1-06H | Recombinant Human Heat Shock 60kDa Protein 1 (Chaperonin) | +Inquiry |
PON1-01H | Active Recombinant Human PON1 Protein, His-tagged | +Inquiry |
ACP7-4252H | Recombinant Human ACP7 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Gallbladder-142H | Human Fetal Gallbladder Lysate | +Inquiry |
RENBP-537HCL | Recombinant Human RENBP lysate | +Inquiry |
HAS3-5633HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
PAWR-3420HCL | Recombinant Human PAWR 293 Cell Lysate | +Inquiry |
Brain Tissue-7H | Human Brain Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *
0
Inquiry Basket