Recombinant Candida albicans (Yeast) SAP6 protein, His-tagged
Cat.No. : | SAP6-4543C |
Product Overview : | Recombinant Candida albicans (Yeast) SAP6 protein(P43095)(77-418a), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
Protein Length : | 77-418a |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.8 kDa |
AA Sequence : | GPVAVKLDNEIITYSADITVGSNNQKLSVIVDTGSSDLWIPDSKAICIPKWRGDCGDFCKNNGSYSPAASSTSKNLNTRFEIKYADGSYAKGNLYQDTVGIGGASVKNQLFANVWSTSAHKGILGIGFQTNEATRTPYDNLPISLKKQGIIAKNAYSLFLNSPEASSGQIIFGGIDKAKYSGSLVELPITSDRTLSVGLRSVNVMGRNVNVNAGVLLDSGTTISYFTPSIARSIIYALGGQVHFDSAGNKAYVADCKTSGTVDFQFDKNLKISVPASEFLYQLYYTNGKPYPKCEIRVRESEDNILGDNFMRSAYIVYDLDDKKISMAQVKYTSESNIVAIN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
SAP6-4543C | Recombinant Candida albicans (Yeast) SAP6 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAP6 Products
Required fields are marked with *
My Review for All SAP6 Products
Required fields are marked with *
0
Inquiry Basket