Recombinant Candida Albicans HWP1 Protein (27-203 aa), His-tagged
Cat.No. : | HWP1-2705C |
Product Overview : | Recombinant Candida Albicans (strain SC5314/ATCC MYA-2876) (Yeast) HWP1 Protein (27-203 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Albicans |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-203 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.7 kDa |
AA Sequence : | GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | HWP1; |
UniProt ID | P46593 |
◆ Recombinant Proteins | ||
HWP1-2705C | Recombinant Candida Albicans HWP1 Protein (27-203 aa), His-tagged | +Inquiry |
HWP1-4039Y | Recombinant Yeast HWP1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HWP1 Products
Required fields are marked with *
My Review for All HWP1 Products
Required fields are marked with *
0
Inquiry Basket