Recombinant C. trachomatis omcA Protein, His-SUMO-tagged
Cat.No. : | omcA-1304C |
Product Overview : | Recombinant Chlamydia trachomatis (strain D/UW-3/Cx) omcA Protein (41-196aa) was expressed in E. coli with N-terminal His-SUMO tag . |
- Specification
- Gene Information
- Related Products
- Download
Species : | C.trachomatis |
Source : | E.coli |
Tag : | His&SUMO |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 33.1 kDa |
AA Sequence : | LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVP EYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWV KPLKEGCCFTAATVCA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | omcA lipoprotein OmcA [ Chlamydia trachomatis D/UW-3/CX ] |
Official Symbol | omcA |
Synonyms | Large cysteine-rich periplasmic protein omcB; Large-CRP; CRP; omcB |
Gene ID | 884216 |
Protein Refseq | NP_219956.1 |
UniProt ID | P0CC05 |
◆ Recombinant Proteins | ||
LAMTOR4-6465H | Recombinant Human LAMTOR4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
INPP4A-119H | Recombinant Human INPP4A, GST-tagged | +Inquiry |
YBDG-3849B | Recombinant Bacillus subtilis YBDG protein, His-tagged | +Inquiry |
IRF1-128H | Recombinant Human IRF1 protein, MYC/DDK-tagged | +Inquiry |
PSIP1-734H | Active Recombinant Human PSIP1 | +Inquiry |
◆ Native Proteins | ||
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
TG-393H | Native Human Thyroglobulin | +Inquiry |
DIS-2020 | Active Cyclodextrin Glucanotransferase (Powder) | +Inquiry |
RWX-308S | Native Snake RVV-X ACTIVATOR | +Inquiry |
Thrombin-21H | Active Native Cattle Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ascending Colon-27H | Human Ascending Colon Membrane Lysate | +Inquiry |
SCAMP3-2048HCL | Recombinant Human SCAMP3 293 Cell Lysate | +Inquiry |
RPTOR-1543HCL | Recombinant Human RPTOR cell lysate | +Inquiry |
NDRG1-3931HCL | Recombinant Human NDRG1 293 Cell Lysate | +Inquiry |
PPP1R16B-2942HCL | Recombinant Human PPP1R16B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All omcA Products
Required fields are marked with *
My Review for All omcA Products
Required fields are marked with *
0
Inquiry Basket