Recombinant C. trachomatis omcA Protein, His-SUMO-tagged
Cat.No. : | omcA-1304C |
Product Overview : | Recombinant Chlamydia trachomatis (strain D/UW-3/Cx) omcA Protein (41-196aa) was expressed in E. coli with N-terminal His-SUMO tag . |
- Specification
- Gene Information
- Related Products
- Download
Species : | C.trachomatis |
Source : | E.coli |
Tag : | His&SUMO |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 33.1 kDa |
AA Sequence : | LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVP EYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWV KPLKEGCCFTAATVCA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | omcA lipoprotein OmcA [ Chlamydia trachomatis D/UW-3/CX ] |
Official Symbol | omcA |
Synonyms | Large cysteine-rich periplasmic protein omcB; Large-CRP; CRP; omcB |
Gene ID | 884216 |
Protein Refseq | NP_219956.1 |
UniProt ID | P0CC05 |
◆ Recombinant Proteins | ||
omcA-3831C | Recombinant Chlamydia trachomatis omcA protein, His-SUMO-tagged | +Inquiry |
omcA-753C | Recombinant Chlamydophila psittaci omcA protein, His&Myc-tagged | +Inquiry |
omcA-1304C | Recombinant C. trachomatis omcA Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All omcA Products
Required fields are marked with *
My Review for All omcA Products
Required fields are marked with *
0
Inquiry Basket