Recombinant C. suffusus Beta-mammal toxin Css4 Protein, His-SUMO-tagged
| Cat.No. : | SCX4-1142C |
| Product Overview : | Recombinant Centruroides suffusus Beta-mammal toxin Css4 Protein (1-66 aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | C.suffusus |
| Source : | E.coli |
| Tag : | His&SUMO |
| ProteinLength : | 1-66 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 23.6 kDa |
| AA Sequence : | KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Beta-mammal toxin Css4 |
| Official Symbol | Beta-mammal toxin Css4 |
| Synonyms | Beta-mammal toxin Css4; Css IV; CssIV |
| UniProt ID | P60266 |
| ◆ Recombinant Proteins | ||
| IL17D-5206H | Recombinant Human IL17D Protein, GST-tagged | +Inquiry |
| GNTI-3532M | Recombinant Mouse-ear cress GNTI protein, His-tagged | +Inquiry |
| birA-1439E | Recombinant Escherichia coli O157:H7 birA Protein (M1-K321), His-tagged | +Inquiry |
| WDR5-2734H | Recombinant Human WD Repeat Domain 5, His-tagged | +Inquiry |
| PAK4-3316H | Recombinant Human PAK4 protein, His-SUMO-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Lectin-1721P | Native Peanut Lectin | +Inquiry |
| Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
| F9-671H | Native Human Coagulation Factor IX | +Inquiry |
| Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
| AZU1-40H | Native Human Azurocidin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLGLB2-3108HCL | Recombinant Human PLGLB2 293 Cell Lysate | +Inquiry |
| TPM4-1036HCL | Recombinant Human TPM4 cell lysate | +Inquiry |
| VPS37B-387HCL | Recombinant Human VPS37B 293 Cell Lysate | +Inquiry |
| GPM6A-5804HCL | Recombinant Human GPM6A 293 Cell Lysate | +Inquiry |
| ONECUT1-3576HCL | Recombinant Human ONECUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Beta-mammal toxin Css4 Products
Required fields are marked with *
My Review for All Beta-mammal toxin Css4 Products
Required fields are marked with *
0
Inquiry Basket
