Recombinant C. pasteurianum Rubredoxin Protein, His-SUMO-tagged

Cat.No. : RUBR-1348C
Product Overview : Recombinant C. pasteurianum Rubredoxin Protein (1-54aa) was expressed in E. coli with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : C.pasteurianum
Source : E.coli
Tag : His&SUMO
Protein Length : 1-54 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 22.0 kDa
AA Sequence : MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Rubredoxin
Official Symbol Rubredoxin
Synonyms Rubredoxin; Rd
UniProt ID P00268

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Rubredoxin Products

Required fields are marked with *

My Review for All Rubredoxin Products

Required fields are marked with *

0

Inquiry Basket

cartIcon