Recombinant C. freundii Dihydroxyacetone kinase Protein, His-SUMO-tagged
Cat.No. : | dhaK-1188C |
Product Overview : | Recombinant Citrobacter freundii Dihydroxyacetone kinase Protein (356-548aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | C.freundii |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 356-548 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 35.9 kDa |
AA Sequence : | ALVAGIVELVTATLSDLETHLNALDAKVGDGDTGSTFAAAAREIASLLHRQQLPLNNLATLFALIGERLT VVMGGSSGVLMSIFFTAAGQKLEQGANVVEALNTGLAQMKFYGGADEGDRTMIDALQPALTSLLAQPKNL QAAFDAAQAGAERTCLSSKANAGRASYLSSESLLGNMDPGAQRLAMVFKALAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Dihydroxyacetone kinase |
Official Symbol | Dihydroxyacetone kinase |
Synonyms | Dihydroxyacetone kinase; DHA kinase; Glycerone kinase; EC= 2.7.1.29; EC 2.7.1.29 |
UniProt ID | P45510 |
◆ Recombinant Proteins | ||
HIST1H3E-3588HF | Recombinant Full Length Human HIST1H3E Protein, GST-tagged | +Inquiry |
Adk-544M | Recombinant Mouse Adk Protein, MYC/DDK-tagged | +Inquiry |
RAB4A-30976TH | Recombinant Human RAB4A, T7 -tagged | +Inquiry |
OLFM2-2981R | Recombinant Rhesus Macaque OLFM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAAP20-953H | Recombinant Human FAAP20 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
FGA-80H | Active Native Human Fibrinogen (plasminogen depleted) | +Inquiry |
VTN -61R | Native Rabbit multimeric vitronectin | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERCC8-6562HCL | Recombinant Human ERCC8 293 Cell Lysate | +Inquiry |
OXER1-1266HCL | Recombinant Human OXER1 cell lysate | +Inquiry |
ACTA1-7HCL | Recombinant Human ACTA1 lysate | +Inquiry |
ECHS1-528HCL | Recombinant Human ECHS1 cell lysate | +Inquiry |
SH3GLB1-1866HCL | Recombinant Human SH3GLB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Dihydroxyacetone kinase Products
Required fields are marked with *
My Review for All Dihydroxyacetone kinase Products
Required fields are marked with *
0
Inquiry Basket