Recombinant C. dactylon Major pollen allergen Cyn d 1 Protein, His/MYC-tagged
| Cat.No. : | CYND1-1178C |
| Product Overview : | Recombinant Cynodon dactylon Major pollen allergen Cyn d 1 Protein (1-246aa) was expressed in E. coli with N-terminal 10XHis tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | C.dactylon |
| Source : | E.coli |
| Tag : | His&Myc |
| ProteinLength : | 1-246 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 31.9 kDa |
| AA Sequence : | AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGC RACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKC KYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPF SIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Major pollen allergen Cyn d 1 |
| Official Symbol | Major pollen allergen Cyn d 1 |
| Synonyms | Major pollen allergen Cyn d 1; CYND1; Cyn d 1 |
| UniProt ID | O04701 |
| ◆ Recombinant Proteins | ||
| Rarres2-2627M | Recombinant Mouse Rarres2 | +Inquiry |
| MYD88-1550H | Recombinant Human Myeloid Differentiation Primary Response Gene (88) | +Inquiry |
| Oleosin L-04S | Recombinant Sesamum indicum Oleosin L Protein, N-10×His tagged | +Inquiry |
| LGALS1-3163H | Recombinant Human LGALS1 protein, His-SUMO-tagged | +Inquiry |
| S-03S | Recombinant SARS-CoV-2 S Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| IgA-239S | Native Sheep Immunoglobulin A | +Inquiry |
| MMP11-27648TH | Native Human MMP11 | +Inquiry |
| GG-182B | Native Bovine Gamma Globulin | +Inquiry |
| BGLAP-57H | Native Human Osteocalcin | +Inquiry |
| Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCUN1D5-7033HCL | Recombinant Human DCUN1D5 293 Cell Lysate | +Inquiry |
| HOXB1-810HCL | Recombinant Human HOXB1 cell lysate | +Inquiry |
| Cerebellum-423S | Sheep Cerebellum Lysate, Total Protein | +Inquiry |
| ANG-20HCL | Recombinant Human ANG lysate | +Inquiry |
| FOXN3-6150HCL | Recombinant Human FOXN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Major pollen allergen Cyn d 1 Products
Required fields are marked with *
My Review for All Major pollen allergen Cyn d 1 Products
Required fields are marked with *
0
Inquiry Basket
