Recombinant C. dactylon Major pollen allergen Cyn d 1 Protein, His/MYC-tagged

Cat.No. : CYND1-1178C
Product Overview : Recombinant Cynodon dactylon Major pollen allergen Cyn d 1 Protein (1-246aa) was expressed in E. coli with N-terminal 10XHis tag and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : C.dactylon
Source : E.coli
Tag : His&Myc
ProteinLength : 1-246 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 31.9 kDa
AA Sequence : AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGC
RACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKC
KYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPF
SIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Major pollen allergen Cyn d 1
Official Symbol Major pollen allergen Cyn d 1
Synonyms Major pollen allergen Cyn d 1; CYND1; Cyn d 1
UniProt ID O04701

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Major pollen allergen Cyn d 1 Products

Required fields are marked with *

My Review for All Major pollen allergen Cyn d 1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon