Recombinant Brugia Malayi JTB Protein (31-105 aa), His-SUMO-tagged
Cat.No. : | JTB-1976B |
Product Overview : | Recombinant Brugia Malayi (Filarial nematode worm) JTB Protein (31-105 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brugia Malayi |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 31-105 aa |
Description : | Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.4 kDa |
AA Sequence : | EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | JTB; |
UniProt ID | O77049 |
◆ Recombinant Proteins | ||
JTB-4691M | Recombinant Mouse JTB Protein, His (Fc)-Avi-tagged | +Inquiry |
JTB-3145R | Recombinant Rat JTB Protein | +Inquiry |
RFL10656RF | Recombinant Full Length Rat Protein Jtb(Jtb) Protein, His-Tagged | +Inquiry |
JTB-1976B | Recombinant Brugia Malayi JTB Protein (31-105 aa), His-SUMO-tagged | +Inquiry |
JTB-2801R | Recombinant Rat JTB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JTB-1040HCL | Recombinant Human JTB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JTB Products
Required fields are marked with *
My Review for All JTB Products
Required fields are marked with *
0
Inquiry Basket