Recombinant Bovine TIMP4 Protein (30-224 aa), His-tagged

• Cat.No.: TIMP4-1541B
• Product Overview: Recombinant Bovine TIMP4 Protein (30-224 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Description: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor.
• Source: Yeast
• Species: Bovine
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.5 kDa
• Protein length: 30-224 aa
• AA Sequence: CSCAPAHPQQHVCHSALAIRAKISSEKVVPASTDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQILSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: TIMP4 TIMP metallopeptidase inhibitor 4 [ Bos taurus (cattle) ]
• Official Symbol: TIMP4
• Synonyms: TIMP4; Tissue inhibitor of metalloproteinases 4; TIMP-4
• Gene ID: 317694
• mRNA Refseq: NM_001045871
• Protein Refseq: NP_001039336
• UniProt ID: O97563