Recombinant Bovine IFNW1 Protein, His-SUMO-tagged
Cat.No. : | IFNW1-1255B |
Product Overview : | Recombinant Bovine IFNW1 Protein (24-195aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 24-195 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHK ERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCA WEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | IFNW1 interferon, omega 1 [ Bos taurus (cattle) ] |
Official Symbol | IFNW1 |
Synonyms | IFNW1; interferon, omega 1; IFN-omega-c1; Interferon alpha-II-1 |
Gene ID | 281847 |
mRNA Refseq | NM_174351.1 |
Protein Refseq | NP_776776.1 |
UniProt ID | P07352 |
◆ Recombinant Proteins | ||
SPTBN1-30885TH | Recombinant Human SPTBN1, His-tagged | +Inquiry |
HTR1A-1994R | Recombinant Rhesus Macaque HTR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
LGALS1-3143H | Recombinant Human LGALS1 Protein (Ala2-Asp135), C-His tagged | +Inquiry |
SST-5759R | Recombinant Rat SST Protein | +Inquiry |
RFL6261MF | Recombinant Full Length Mouse Sperm-Associated Antigen 4 Protein(Spag4) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
F10-63H | Native Human Factor X | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
ALB-37G | Native Goat Albumin (ALB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC15-8346HCL | Recombinant Human C11orf51 293 Cell Lysate | +Inquiry |
GNRH1-5839HCL | Recombinant Human GNRH1 293 Cell Lysate | +Inquiry |
PPM1F-2961HCL | Recombinant Human PPM1F 293 Cell Lysate | +Inquiry |
MAP4K4-4500HCL | Recombinant Human MAP4K4 293 Cell Lysate | +Inquiry |
MBL1-1113RCL | Recombinant Rat MBL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNW1 Products
Required fields are marked with *
My Review for All IFNW1 Products
Required fields are marked with *
0
Inquiry Basket