Recombinant Bovine GPR52 protein(1-44aa), His-KSI-tagged

Cat.No. : GPR52-3022B
Product Overview : Recombinant Bovine GPR52 protein(A6QLE7)(1-44aa), fused with N-terminal His and KSI tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Bovine
Tag : N-His-KSI
Protein length : 1-44aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.4 kDa
AASequence : MNDSRWTEWRILNTSSGILNVSERHSCPLGFGHYSAVDVCIFET
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GPR52 Products

Required fields are marked with *

My Review for All GPR52 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon