Recombinant Bovine CYCT protein, His-tagged
Cat.No. : | CYCT-674B |
Product Overview : | Recombinant Bovine CYCT protein(Q3SZT9)(2-105aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His |
ProteinLength : | 2-105aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.7 kDa |
AASequence : | ADAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTEANKNKGIIWGEQTLMEYLENPKKYIPGTKMIFAGLKKKSEREDLIEYLKQATSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Native Proteins | ||
F9-300R | Native Rat Factor IX | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
CTLGV2EB-359C | Active Native Chlamydia trachomatis LGV Type-2 EB Protein | +Inquiry |
LDL-333H | Native Human LDL Protein | +Inquiry |
VTN-385P | Native Pig Vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNB2L1-5862HCL | Recombinant Human GNB2L1 293 Cell Lysate | +Inquiry |
KLF11-4932HCL | Recombinant Human KLF11 293 Cell Lysate | +Inquiry |
ATP5I-8598HCL | Recombinant Human ATP5I 293 Cell Lysate | +Inquiry |
GFRA4-5952HCL | Recombinant Human GFRA4 Cell Lysate, transcript variant 2 | +Inquiry |
LYRM1-4586HCL | Recombinant Human LYRM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYCT Products
Required fields are marked with *
My Review for All CYCT Products
Required fields are marked with *
0
Inquiry Basket