Recombinant Bovine CD8A Protein (26-189 aa), His-SUMO-tagged
Cat.No. : | CD8A-401B |
Product Overview : | Recombinant Bovine CD8A Protein (26-189 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-189 aa |
Description : | Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 33.9 kDa |
AA Sequence : | LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CD8A CD8a molecule [ Bos taurus (cattle) ] |
Official Symbol | CD8A |
Gene ID | 281060 |
mRNA Refseq | NM_174015 |
Protein Refseq | NP_776440 |
UniProt ID | P31783 |
◆ Cell & Tissue Lysates | ||
CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD8A Products
Required fields are marked with *
My Review for All CD8A Products
Required fields are marked with *
0
Inquiry Basket