Recombinant Bovine CD8A Protein (26-189 aa), His-SUMO-tagged

• Cat.No.: CD8A-401B
• Product Overview: Recombinant Bovine CD8A Protein (26-189 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 26-189 aa
• Description: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 33.9 kDa
• AA Sequence: LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: CD8A CD8a molecule [ Bos taurus (cattle) ]
• Official Symbol: CD8A
• Gene ID: 281060
• mRNA Refseq: NM_174015
• Protein Refseq: NP_776440
• UniProt ID: P31783