Recombinant Bos PRNP Protein, His-Tagged

• Cat.No.: Prnp-01B
• Product Overview: Recombinant Bos PRNP Protein, His-Tagged was expressed in E.coli BL21 cell

Specification

• Species: Bos
• Source: E.coli
• Tag: His
• Description: The function of PrP is still under debate. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May play a role in iron uptake and iron homeostasis (By similarity). Isoform 2 may act as a growth suppressor by arresting the cell cycle at the G0/G1 phase. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro).
• Form: Liquid
• Molecular Mass: 25 kDa including tags
• AA Sequence: MKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASHHHHHH
• Purity: > 95 % SDS-PAGE.
  Expressed in E.coli BL21, solubilized from inclusion bodies in 6 M guanidine-HCl, and purified by Ni(II)-nitriloacetate agarose chromatography, followed by reversed-phase HPLC (C4 column). The rPrPc appears as a single protein band of about 27 kDa in SDS-PAGE (>95% of total protein).
• Applications: SDS-PAGE, ELISA
• Storage: Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  pH: 4.00
  Constituent: 0.082% Sodium acetate
• Concentration: 100 µg at 2 mg/ml
• Shipping: Shipped at 4°C.

Gene Information

• Gene Name: PRNP prion protein [ Bos taurus (cattle) ]
• Official Symbol: PRNP
• Synonyms: AltPrP, ASCR, CD230, CD230 antigen, CJD, GSS, KURU, Major prion protein, p27 30, PRIO_HUMAN, Prion protein, Prion related protein, PRIP, PRNP, PrP, PrP27 30, PrP27-30, PrP33-35C, PrPC, PrPSc, Sinc
• Gene ID: 281427
• mRNA Refseq: NM_001271625.3
• Protein Refseq: NP_001258554.1
• UniProt ID: F7VJQ2