Recombinant Borrelia Burgdorferi CLPP2 Protein (1-198 aa), His-SUMO-Myc-tagged

• Cat.No.: CLPP2-2304B
• Product Overview: Recombinant Borrelia Burgdorferi (strain ATCC 35210/B31/CIP 102532/DSM 4680) CLPP2 Protein (1-198 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Borrelia Burgdorferi
• Source: E.coli
• Tag: His&Myc&SUMO
• ProteinLength: 1-198 aa
• Description: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 42.2 kDa
• AA Sequence: MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: clpP2
• UniProt ID: O51698