Recombinant Bordetella Pertussis PTXA Protein (35-269 aa), His-tagged

• Cat.No.: PTXA-1609B
• Product Overview: Recombinant Bordetella Pertussis (strain Tohama I/ATCC BAA-589/NCTC 13251) PTXA Protein (35-269 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Bordetella Pertussis
• Source: Yeast
• Tag: His
• Protein Length: 35-269 aa
• Description: S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD+ into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their mbrane receptors.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.2 kDa
• AA Sequence: DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: ptxA pertussis toxin subunit 1 [ Bordetella pertussis Tohama I ]
• Official Symbol: PTXA
• Synonyms: ptxA; Islet-activating protein S1; IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-)
• Gene ID: 2665068
• Protein Refseq: NP_882282
• UniProt ID: P04977