Recombinant Barley DHN1 Protein (1-139 aa), His-Myc-tagged

• Cat.No.: DHN1-2773B
• Product Overview: Recombinant Barley (Hordeum vulgare) DHN1 Protein (1-139 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Barley
• Source: Insect Cells
• Tag: His&Myc
• ProteinLength: 1-139 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 18.2 kDa
• AA Sequence: MEYQGQHGHATDKVEEYGQPVAGHGGFTGGPTGTHGAAGVGGAQLQATRDGHKTDGVLRRSGSSSSSSSEDDGVGGRRKKGMKEKIKEKLPGGAHKDAAGQQQQTAMAGEYAGTHGTEATGEKKGVMDKIKEKLPGGQH
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: DHN1
• UniProt ID: P12951