Recombinant Bacteroides symbiosus ppdK protein, His&Myc-tagged
Cat.No. : | ppdK-4489B |
Product Overview : | Recombinant Bacteroides symbiosus ppdK protein(P22983)(384-511aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacteroides symbiosus |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 384-511aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.5 kDa |
AA Sequence : | AALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARGMGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYKGDIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
ppdK-4489B | Recombinant Bacteroides symbiosus ppdK protein, His&Myc-tagged | +Inquiry |
PPDK-916E | Recombinant Entamoeba Histolytica PPDK Protein (1-342 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ppdK Products
Required fields are marked with *
My Review for All ppdK Products
Required fields are marked with *
0
Inquiry Basket