Recombinant Bacillus Thuringiensis Subsp. Morrisoni CRY1FB Protein (984-1159 aa), His-tagged

• Cat.No.: CRY1FB-1646P
• Product Overview: Recombinant Bacillus Thuringiensis Subsp. Morrisoni CRY1FB Protein (984-1159 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Bacillus thuringiensis
• Source: Yeast
• Tag: His
• Protein Length: 984-1159 aa
• Description: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.6 kDa
• AA Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: cry1Fb; 132 kDa crystal protein Crystaline entomocidal protoxin Insecticidal delta-endotoxin CryIF(b)
• UniProt ID: O66377