Recombinant Bacillus thuringiensis cry1Ab Protein, His-tagged

• Cat.No.: cry1Ab-01B
• Product Overview: Recombinant Bacillus Thuringiensis Cry1Ab Protein (1022-1155aa) with a N-terminal 6xHis tag was expressed in E. coli.

Specification

• Species: Bacillus thuringiensis
• Source: E.coli
• Tag: His
• ProteinLength: 1022-1155 a.a.
• Description: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of lepidopteran (Manduca sexta) larvae.
• Molecular Mass: 17.3 kDa
• AA Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
• Purity: >90% as determined by SDS-PAGE.

Gene Information

• Gene Name: BTHUR0008_RS31135 insecticidal delta-endotoxin Cry8Ea1 family protein [ Bacillus thuringiensis serovar berliner ATCC 10792 ]
• Official Symbol: cry1Ab
• Synonyms: BTHUR0008_RS31135; insecticidal delta-endotoxin Cry8Ea1 family protein; insecticidal delta-endotoxin Cry8Ea1 family protein; cry1Ab
• Gene ID: 67470639
• Protein Refseq: WP_000369819
• UniProt ID: P0A370