Recombinant Bacillus thuringiensis cry1Ab Protein, His-tagged
| Cat.No. : | cry1Ab-01B |
| Product Overview : | Recombinant Bacillus Thuringiensis Cry1Ab Protein (1022-1155aa) with a N-terminal 6xHis tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bacillus thuringiensis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1022-1155 a.a. |
| Description : | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of lepidopteran (Manduca sexta) larvae. |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
| Purity : | >90% as determined by SDS-PAGE. |
| Gene Name | BTHUR0008_RS31135 insecticidal delta-endotoxin Cry8Ea1 family protein [ Bacillus thuringiensis serovar berliner ATCC 10792 ] |
| Official Symbol | cry1Ab |
| Synonyms | BTHUR0008_RS31135; insecticidal delta-endotoxin Cry8Ea1 family protein; insecticidal delta-endotoxin Cry8Ea1 family protein; cry1Ab |
| Gene ID | 67470639 |
| Protein Refseq | WP_000369819 |
| UniProt ID | P0A370 |
| ◆ Native Proteins | ||
| Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
| Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cry1Ab Products
Required fields are marked with *
My Review for All cry1Ab Products
Required fields are marked with *
0
Inquiry Basket
