Recombinant Bacillus subtilis sacA Protein, His-tagged

Cat.No. : sacA-39B
Product Overview : Recombinant Human GPX4 Protein, fused to Flag-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bacillus subtilis
Source : E.coli
Tag : His
Description : Sucrose-6-phosphate hydrolase
Form : 50mM Tris 300mM NaCl, pH 8.0.
Molecular Mass : 58.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMTTTDAALRQKIADRIRNYEHLVKKDVYRQHFHLMPPVGLLNDPNGLIQWKGIYHVFYQWQPFKTGHGAKFWGHYTSTDLVNWQHEEAALAPSDWFDQNGCYSGSAFIDDGQMHVMYTGNVRDEQGNRETYQCLAVSEDGIHFQKKGVVATLPEGFTAHFRDPKVWKRNGQWYMVLGAQSLDLKGHLVLFTSDTLDNWTFQGTIAGSGKNGLDNFGYMWECPDLFELDGRDVLIVSPQGLEPDGLKYHNTHQSGYFVGTLDDHSYQYTHGAFEELDRGFDFYAQQTFLDESGRRLLIGWMGVPDQGEEHHPTISYQWIHCLTIPRELRLDEDGHLIQKPVSELQSMRTNEQEHVFHIKRSVHSIPVEDITSAEVFIDQIDTQKGFECCIRAAARIIYDKEEGKLTLERDRFEDRSKEVREAVIEELHDLHIFIDSSSIEIFVNGGREVFTARYFPSPGNKSISISGRNETKLKLKAWHLQREADQ
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.8 mg/ml

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All sacA Products

Required fields are marked with *

My Review for All sacA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon