Recombinant Bacillus subtilis sacA Protein, His-tagged
Cat.No. : | sacA-39B |
Product Overview : | Recombinant Human GPX4 Protein, fused to Flag-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
Description : | Sucrose-6-phosphate hydrolase |
Form : | 50mM Tris 300mM NaCl, pH 8.0. |
Molecular Mass : | 58.1 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMTTTDAALRQKIADRIRNYEHLVKKDVYRQHFHLMPPVGLLNDPNGLIQWKGIYHVFYQWQPFKTGHGAKFWGHYTSTDLVNWQHEEAALAPSDWFDQNGCYSGSAFIDDGQMHVMYTGNVRDEQGNRETYQCLAVSEDGIHFQKKGVVATLPEGFTAHFRDPKVWKRNGQWYMVLGAQSLDLKGHLVLFTSDTLDNWTFQGTIAGSGKNGLDNFGYMWECPDLFELDGRDVLIVSPQGLEPDGLKYHNTHQSGYFVGTLDDHSYQYTHGAFEELDRGFDFYAQQTFLDESGRRLLIGWMGVPDQGEEHHPTISYQWIHCLTIPRELRLDEDGHLIQKPVSELQSMRTNEQEHVFHIKRSVHSIPVEDITSAEVFIDQIDTQKGFECCIRAAARIIYDKEEGKLTLERDRFEDRSKEVREAVIEELHDLHIFIDSSSIEIFVNGGREVFTARYFPSPGNKSISISGRNETKLKLKAWHLQREADQ |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.8 mg/ml |
Gene Name | sacA sucrose-6-phosphate hydrolase [ Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 ] |
Official Symbol | sacA |
Gene ID | 64305577 |
Protein Refseq | WP_003222146 |
UniProt ID | P07819 |
◆ Native Proteins | ||
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
Collagen Type I-02M | Native Mouse Collagen Type I (Atelocollagen) Protein | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
ATF-177D | Native Dog Apotransferrin | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KBTBD5-5082HCL | Recombinant Human KBTBD5 293 Cell Lysate | +Inquiry |
NF2-3862HCL | Recombinant Human NF2 293 Cell Lysate | +Inquiry |
HA-2350HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
SAAL1-2077HCL | Recombinant Human SAAL1 293 Cell Lysate | +Inquiry |
Kidney-072MCL | Adult Mouse Kidney Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All sacA Products
Required fields are marked with *
My Review for All sacA Products
Required fields are marked with *
0
Inquiry Basket