Recombinant B. subtilis pbpE Protein, His-SUMO-tagged
Cat.No. : | pbpE-1323B |
Product Overview : | Recombinant B. subtilis pbpE Protein (1-451aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | B.subtilis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-451 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 67.4 kDa |
AA Sequence : | MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | pbpE penicillin-binding protein 4 [ Bacillus subtilis subsp. subtilis str. 168 ] |
Official Symbol | pbpE |
Synonyms | penicillin-binding protein 4; |
Gene ID | 938615 |
Protein Refseq | NP_391324.1 |
UniProt ID | P32959 |
◆ Recombinant Proteins | ||
pbpE-1323B | Recombinant B. subtilis pbpE Protein, His-SUMO-tagged | +Inquiry |
PBPE-0583B | Recombinant Bacillus subtilis PBPE protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pbpE Products
Required fields are marked with *
My Review for All pbpE Products
Required fields are marked with *
0
Inquiry Basket