Recombinant B. subtilis pbpC Protein, His-tagged
Cat.No. : | pbpC-1321B |
Product Overview : | Recombinant B. subtilis pbpC Protein (21-240aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | B.subtilis |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-240 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.2 kDa |
AA Sequence : | CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDD QDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRG QIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKP DQEKLVSEAT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | pbpC penicillin-binding protein 3 [ Bacillus subtilis subsp. subtilis str. 168 ] |
Official Symbol | pbpC |
Synonyms | penicillin-binding protein 3 |
Gene ID | 940139 |
Protein Refseq | NP_388295.1 |
UniProt ID | P42971 |
◆ Recombinant Proteins | ||
pbpC-1321B | Recombinant B. subtilis pbpC Protein, His-tagged | +Inquiry |
PBPC-1063B | Recombinant Bacillus subtilis PBPC protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pbpC Products
Required fields are marked with *
My Review for All pbpC Products
Required fields are marked with *
0
Inquiry Basket