Recombinant B. pertussis prn Protein, His-SUMO-tagged

• Cat.No.: Reg1-1349M
• Product Overview: Recombinant B. pertussis prn Protein (632-919aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: B.pertussis
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 632-919 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 32.2 kDa
• AA Sequence: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESG
  TTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVC
  KFKG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Reg1 regenerating islet-derived 1 [ Mus musculus (house mouse) ]
• Official Symbol: Reg1
• Synonyms: Reg1; PSP; PTP; REG 1; islet of Langerhans regenerating protein 1; pancreatic stone protein 1; pancreatic thread protein 1; regenerating islet-derived, mouse homolog 1; regenerating protein 1; lithostathine-1
• Gene ID: 19692
• mRNA Refseq: NM_009042.1
• Protein Refseq: NP_033068.1
• UniProt ID: P43137