Recombinant Azotobacter Vinelandii ALGL Protein (24-374 aa), His-SUMO-Myc-tagged

• Cat.No.: ALGL-2178A
• Product Overview: Recombinant Azotobacter Vinelandii ALGL Protein (24-374 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Azotobacter Vinelandii
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 24-374 aa
• Description: Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues. May serve to degrade mislocalized alginate that is trapped in the periplasmic space.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 59.0 kDa
• AA Sequence: AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: algL; Poly(beta-D-mannuronate) lyase
• UniProt ID: O52195