Recombinant Arabidopsis Thaliana LCR83 Protein (28-82 aa), GST-tagged

• Cat.No.: LCR83-1563A
• Product Overview: Recombinant Arabidopsis Thaliana (Mouse-ear cress) LCR83 Protein (28-82 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Arabidopsis Thaliana
• Source: Yeast
• Tag: GST
• ProteinLength: 28-82 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 32.9 kDa
• AA Sequence: NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: LCR83 low-molecular-weight cysteine-rich 83 [ Arabidopsis thaliana (thale cress) ]
• Official Symbol: LCR83
• Synonyms: low-molecular-weight cysteine-rich 83
• Gene ID: 3771507
• mRNA Refseq: NM_001036997
• Protein Refseq: NP_001032074
• UniProt ID: P82792