Recombinant Arabidopsis Thaliana AXR3 Protein (1-229 aa), His-Myc-tagged
Cat.No. : | AXR3-2670A |
Product Overview : | Recombinant Arabidopsis Thaliana (Mouse-ear cress) AXR3 Protein (1-229 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis Thaliana |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-229 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 32.3 kDa |
AA Sequence : | MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | AXR3 AUX/IAA transcriptional regulator family protein [ Arabidopsis thaliana (thale cress) ] |
Official Symbol | AXR3 |
Synonyms | AXR3; AtIAA17; AUXIN RESISTANT 3; F19P19.31; F19P19_31; IAA17; indole-3-acetic acid inducible 17; |
Gene ID | 839568 |
mRNA Refseq | NM_100306 |
Protein Refseq | NP_171921 |
UniProt ID | P93830 |
◆ Recombinant Proteins | ||
AXR3-2670A | Recombinant Arabidopsis Thaliana AXR3 Protein (1-229 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AXR3 Products
Required fields are marked with *
My Review for All AXR3 Products
Required fields are marked with *
0
Inquiry Basket