Recombinant Arabidopsis Thaliana APX2 Protein (4-250 aa), His-tagged

• Cat.No.: APX2-1271A
• Product Overview: Recombinant Arabidopsis Thaliana (Mouse-ear cress) APX2 Protein (4-250 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Arabidopsis Thaliana
• Source: E.coli
• Tag: His
• ProteinLength: 4-250 aa
• Description: Plays a key role in hydrogen peroxide roval.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.5 kDa
• AA Sequence: KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: APX2 ascorbate peroxidase 2 [ Arabidopsis thaliana (thale cress) ]
• Official Symbol: APX2
• Synonyms: APX1B; ASCORBATE PEROXIDASE 1B; ascorbate peroxidase 2; CS2
• Gene ID: 820121
• mRNA Refseq: NM_111798
• Protein Refseq: NP_187575
• UniProt ID: Q1PER6