Recombinant Apple Major allergen Mal d 1 Protein, His-SUMO-tagged

• Cat.No.: MALD1-1273A
• Product Overview: Recombinant Apple Major allergen Mal d 1 Protein (2-159aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Species: Apple
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 2-159 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 33.5 kDa
• AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHR
  IDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAH
  GLFKLIESYLKDHPDAYN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: LOC103425638 major allergen Mal d 1 [ Malus domestica (apple) ]
• Official Symbol: major allergen Mal d 1
• Synonyms: major allergen Mal d 1; Allergen Mal d I; Mal d 1; Allergen; Mal d 1-like; Mal d 1.01; Mal d 1.02; Mal d 1.0201; Mal d 1.0209; PR-10 protein; allergen Mal d 1.02; major allergen Mal d 1.02; major allergen d 1; putative Mal d 1.02 isoallergen
• Gene ID: 103425638
• mRNA Refseq: NM_001294363.1
• Protein Refseq: NP_001281292.1
• UniProt ID: P43211