Recombinant Anaplasma Phagocytophilum RPLV Protein (1-112 aa), His-Myc-tagged
Cat.No. : | RPLV-2207A |
Product Overview : | Recombinant Anaplasma Phagocytophilum (strain HZ) RPLV Protein (1-112 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anaplasma Phagocytophilum |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-112 aa |
Description : | This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome.UniRule annotation The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.2 kDa |
AA Sequence : | MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | rplV; |
UniProt ID | Q2GL54 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPLV Products
Required fields are marked with *
My Review for All RPLV Products
Required fields are marked with *
0
Inquiry Basket