Recombinant Alternaria arborescens ALTA1 Protein, His-tagged

• Cat.No.: ALTA1-08A
• Product Overview: Recombinant Alternaria arborescens ALTA1 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Alternaria arborescens
• Source: E.coli
• Tag: His
• Description: Major allergen Alt a 1
• Form: PBS (pH 7.4)
• Molecular Mass: 16.7 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS
• Purity: > 90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1mg/ml

Gene Information

• Gene Name: AA0111_g6065 Major allergen Alt a 1 [ Alternaria arborescens ]
• Official Symbol: ALTA1
• Gene ID: 39621843
• mRNA Refseq: XM_028652247
• Protein Refseq: XP_028506422
• UniProt ID: P79085