Recombinant Aequorea victoria Aequorin Protein

• Cat.No.: Aequorin-155
• Product Overview: Recombinant Aequorea victoria Aequorin was expressed in E. coli.

Specification

• Species: Aequorea victoria
• Source: E.coli
• Tag: Non
• Description: Aequorin, a photoprotein originating from the jellyfish Aequorea victoria emits light in the presence of a trace amount of Ca2+ without the requirement of any other cofactor. Aequorin was “charged” with unmodified (native) Coelenterazine and will emit light at 465 nm upon Ca2+ contact.
• AA Sequence: MTSKQYSVKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
• Purity: > 95% by SDS-PAGE
• Applications: postitive control in Ca2+ assays
• Storage: Store at -20 centigrade or below upon arrival.
• Reconstitution: with Ca2+ free double distilled water