Recombinant Active Mouse IL3 Protein, His-tagged(C-ter)

• Cat.No.: Il3-188M
• Product Overview: Recombinant Active Mouse IL3 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce NFS-60 cells proliferation. The ED50 for this effect is < 85 pg/ml. The specific activity of recombinant mouse IL-3 is approximately > 1x 10^7 IU/mg.
• AA Sequence: MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Il3 interleukin 3 [ Mus musculus ]
• Official Symbol: Il3
• Synonyms: IL3; interleukin 3; interleukin-3; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; BPA; PSF; HCGF; Il-3; MCGF; Csfmu
• Gene ID: 16187
• mRNA Refseq: NM_010556
• Protein Refseq: NP_034686