Recombinant Active Mouse CSF1 Protein, His-tagged(C-ter)

• Cat.No.: Csf1-46M
• Product Overview: Recombinant Active Mouse CSF1 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Powder
• Bio-activity: Determined by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is < 2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately > 5x 10^5 IU/mg.
• AA Sequence: MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFDETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Csf1 colony stimulating factor 1 (macrophage) [ Mus musculus ]
• Official Symbol: Csf1
• Synonyms: CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; osteopetrosis; op; Csfm; MCSF; C87615
• Gene ID: 12977
• mRNA Refseq: NM_001113529
• Protein Refseq: NP_001107001