Recombinant Active Human IFNL3 Protein, His-tagged(C-ter)

• Cat.No.: IFNL3-123H
• Product Overview: Recombinant Active Human IFNL3 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 5 ng/mL.
• AA Sequence: MVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
• Endotoxin: Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
• Purity: > 95% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IFNL3 interferon lambda 3 [ Homo sapiens (human) ]
• Official Symbol: IFNL3
• Synonyms: IFNL3; interferon lambda 3; IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4; interferon lambda-3; cytokine Zcyto22; interferon, lambda 4; interleukin-28B; interleukin-28C
• Gene ID: 282617
• mRNA Refseq: NM_172139
• Protein Refseq: NP_742151
• MIM: 607402
• UniProt ID: Q8IZI9