Recombinant Active Human BMP5 Protein, His-tagged(C-ter)
Cat.No. : | BMP5-15H |
Product Overview : | Recombinant Active Human BMP5 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 0.17 μg/mL. |
AA Sequence : | MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | BMP5 bone morphogenetic protein 5 [ Homo sapiens ] |
Official Symbol | BMP5 |
Synonyms | BMP5; bone morphogenetic protein 5; BMP-5; MGC34244; |
Gene ID | 653 |
mRNA Refseq | NM_021073 |
Protein Refseq | NP_066551 |
MIM | 112265 |
UniProt ID | P22003 |
◆ Recombinant Proteins | ||
BMP5-270H | Recombinant Human BMP5 Protein, GST-tagged | +Inquiry |
BMP5-259H | Recombinant Human BMP5 Protein, His-tagged | +Inquiry |
BMP5-271H | Recombinant Human BMP5 Protein, GST-tagged | +Inquiry |
BMP5-26H | Recombinant Human Bone Morphogenetic Protein 5 | +Inquiry |
BMP5-4365H | Recombinant Human BMP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP5-3074HCL | Recombinant Human BMP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP5 Products
Required fields are marked with *
My Review for All BMP5 Products
Required fields are marked with *
0
Inquiry Basket