Recombinant Active Human BMP4 Protein, His-tagged(C-ter)
Cat.No. : | BMP4-13H |
Product Overview : | Recombinant Active Human BMP4 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 0.58 ng/mL. |
AA Sequence : | MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium carbonate (pH 9.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | BMP4 bone morphogenetic protein 4 [ Homo sapiens ] |
Official Symbol | BMP4 |
Synonyms | BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6; |
Gene ID | 652 |
mRNA Refseq | NM_001202 |
Protein Refseq | NP_001193 |
MIM | 112262 |
UniProt ID | P12644 |
◆ Recombinant Proteins | ||
BMP4-570P | Recombinant Pig BMP4 protein, His-tagged | +Inquiry |
BMP4-6790C | Recombinant Chicken BMP4 | +Inquiry |
BMP4-11H | Active Recombinant Human BMP4 Protein, Pre-aliquoted | +Inquiry |
BMP4-24H | Recombinant Human BMP4 Protein, Ser293-Arg408 | +Inquiry |
BMP4-575R | Recombinant Rabbit BMP4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
0
Inquiry Basket