Recombinant Active Human BMP3 Protein, His-tagged(C-ter)

• Cat.No.: BMP3-12H
• Product Overview: Recombinant Active Human BMP3 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 9.5 ng/mL.
• AA Sequence: MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 95% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: BMP3 bone morphogenetic protein 3 [ Homo sapiens ]
• Official Symbol: BMP3
• Synonyms: BMP3; bone morphogenetic protein 3; bone morphogenetic protein 3 (osteogenic); osteogenin; BMP-3; bone morphogenetic protein-3; bone morphogenetic protein 3A; BMP-3A
• Gene ID: 651
• mRNA Refseq: NM_001201
• Protein Refseq: NP_001192
• MIM: 112263
• UniProt ID: P12645