Recombinant Active Human BMP3 Protein, His-tagged(C-ter)
Cat.No. : | BMP3-12H |
Product Overview : | Recombinant Active Human BMP3 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 9.5 ng/mL. |
AA Sequence : | MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | BMP3 bone morphogenetic protein 3 [ Homo sapiens ] |
Official Symbol | BMP3 |
Synonyms | BMP3; bone morphogenetic protein 3; bone morphogenetic protein 3 (osteogenic); osteogenin; BMP-3; bone morphogenetic protein-3; bone morphogenetic protein 3A; BMP-3A; |
Gene ID | 651 |
mRNA Refseq | NM_001201 |
Protein Refseq | NP_001192 |
MIM | 112263 |
UniProt ID | P12645 |
◆ Recombinant Proteins | ||
BMP3-26427TH | Recombinant Human BMP3 | +Inquiry |
BMP3-1724HF | Recombinant Full Length Human BMP3 Protein, GST-tagged | +Inquiry |
BMP3-264H | Recombinant Human BMP3 Protein, GST-tagged | +Inquiry |
BMP3-2588M | Recombinant Mouse BMP3 Protein (359-468 aa), His-tagged | +Inquiry |
BMP3-3277C | Recombinant Chicken BMP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP3 Products
Required fields are marked with *
My Review for All BMP3 Products
Required fields are marked with *
0
Inquiry Basket