Recombinant Active Human BMP15 Protein, His-tagged(C-ter)

• Cat.No.: BMP15-10H
• Product Overview: Recombinant Active Human BMP15 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The transforming growth factor-beta superfamily includes large families of growth and differentiation factors. It is thought that this protein may be involved in oocyte maturation and follicular development as a homodimer or by forming heterodimers with a related protein, Gdf9. Defects in this gene are the cause of ovarian dysgenesis 2.[provided by RefSeq, Sep 2009]
• Form: Powder
• Bio-activity: Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 17 ng/mL.
• AA Sequence: MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: BMP15 bone morphogenetic protein 15 [ Homo sapiens ]
• Official Symbol: BMP15
• Synonyms: BMP15; bone morphogenetic protein 15; GDF9B; BMP-15; GDF-9B; growth/differentiation factor 9B; ODG2; POF4
• Gene ID: 9210
• mRNA Refseq: NM_005448
• Protein Refseq: NP_005439
• MIM: 300247
• UniProt ID: O95972