Recombinant Active Human BMP15 Protein, His-tagged(C-ter)
Cat.No. : | BMP15-10H |
Product Overview : | Recombinant Active Human BMP15 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The transforming growth factor-beta superfamily includes large families of growth and differentiation factors. It is thought that this protein may be involved in oocyte maturation and follicular development as a homodimer or by forming heterodimers with a related protein, Gdf9. Defects in this gene are the cause of ovarian dysgenesis 2.[provided by RefSeq, Sep 2009] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 17 ng/mL. |
AA Sequence : | MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | BMP15 bone morphogenetic protein 15 [ Homo sapiens ] |
Official Symbol | BMP15 |
Synonyms | BMP15; bone morphogenetic protein 15; GDF9B; BMP-15; GDF-9B; growth/differentiation factor 9B; ODG2; POF4; |
Gene ID | 9210 |
mRNA Refseq | NM_005448 |
Protein Refseq | NP_005439 |
MIM | 300247 |
UniProt ID | O95972 |
◆ Recombinant Proteins | ||
BMP15-579H | Active Recombinant Human Bone Morphogenetic Protein 15 | +Inquiry |
BMP15-2687Z | Recombinant Zebrafish BMP15 | +Inquiry |
BMP15-0777H | Recombinant Human BMP15 Protein (Thr266-Ser388), His tagged | +Inquiry |
BMP15-10H | Recombinant Active Human BMP15 Protein, His-tagged(C-ter) | +Inquiry |
BMP15-010H | Active Recombinant Human BMP15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP15-66HCL | Recombinant Human BMP15 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP15 Products
Required fields are marked with *
My Review for All BMP15 Products
Required fields are marked with *
0
Inquiry Basket