Recombinant Active Human ATAD2B Protein (953 to 1080), C-6×His tagged

• Cat.No.: ATAD2B-12H
• Product Overview: Recombinant Active Human ATAD2B Protein (953-1080) with C-6×His tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene belongs to the AAA ATPase family. This family member includes an N-terminal bromodomain. It has been found to be localized to the nucleus, partly to replication sites, consistent with a chromatin-related function. Alternative splicing of this gene results in multiple transcript variants.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Liquid
• Molecular Mass: Predicted molecular weight: 42 kDa including tags
• Protein length: 953 to 1080
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKE
• Purity: > 95% SDS-PAGE
• Applications: Functional Studies, SDS-PAGE
• Storage Buffer: pH: 8
  Constituents: 0.48% Tris, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride
  This product is an active protein and may elicit a biological response in vivo, handle with caution.
• Shipping: Shipped on Dry Ice. Store at -80 centigrade. Avoid freeze/thaw cycle.

Gene Information

• Gene Name: ATAD2B ATPase family AAA domain containing 2B [ Homo sapiens (human) ]
• Official Symbol: ATAD2B
• Synonyms: ATAD2B; ATPase family AAA domain containing 2B; ATPase family AAA domain-containing protein 2B
• Gene ID: 54454
• mRNA Refseq: NM_017552
• Protein Refseq: NP_060022
• MIM: 615347
• UniProt ID: Q9ULI0