Recombinant Acinetobacter Baumannii NDM1 Protein (164-222 aa), His-SUMO-tagged

• Cat.No.: NDM1-1217A
• Product Overview: Recombinant Acinetobacter Baumannii NDM1 Protein (164-222 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Acinetobacter Baumannii
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 164-222 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.0 kDa
• AA Sequence: AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: NDM-1
• UniProt ID: F8UNN7